PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13690g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 801aa    MW: 89196.5 Da    PI: 6.5522
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf13690g01010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23167268199
                               EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                               f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD 
  Niben101Scf13690g01010.1 167 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDA 250
                               99****************************86333.45679******************************************** PP

                               EEEEE-SSSEE..EEEEE-S CS
                        B3  80 vvFkldgrsefelvvkvfrk 99 
                               v+F   + +++ l+++++r+
  Niben101Scf13690g01010.1 251 VLFL--RGEGGDLRLGIRRA 268
                               ****..4489999**99986 PP

2Auxin_resp112.54e-37293374182
                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                               +a+a+s ks+F+v+Y+Pras+++Fvv+++k++k++++++ v +Rfkm+f+ +ds+err+sG+v+g+ d+dp+rWpnSkWr+L
  Niben101Scf13690g01010.1 293 VATAVSVKSTFHVFYSPRASHADFVVPYQKYMKSINSRIPVRTRFKMRFDLDDSPERRYSGVVTGIGDMDPFRWPNSKWRCL 374
                               68999****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.79E-44159285IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-40160280IPR015300DNA-binding pseudobarrel domain
CDDcd100174.81E-22165267No hitNo description
PfamPF023622.4E-21167268IPR003340B3 DNA binding domain
SMARTSM010193.8E-23167269IPR003340B3 DNA binding domain
PROSITE profilePS5086312.901167269IPR003340B3 DNA binding domain
PfamPF065072.5E-31294374IPR010525Auxin response factor
SuperFamilySSF542775.89E-11666752No hitNo description
PfamPF023092.7E-6669757IPR033389AUX/IAA domain
PROSITE profilePS5174521.745673757IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 801 aa     Download sequence    Send to blast
MEIDLNHAVV SEVEKNACCN GECDKKGVGG SCVNCNLSTT STSSCSSNAS SSSSSSLTLS  60
SIYMELWHAC AGPLTSLPKK GNVVVYFPQG HMEEAVSVSP FSPIKMDFPT FGLQPQIFCK  120
VEDVQLLANK ENDESVAISL KGKEHEDFGV DEEGNGVNPG KSASHMFCKT LTASDTSTHG  180
GFSVPRRAAE DCFPPLDYKE QRPSQELIAK DLHGVEWKFR HIYRGQPRRH LLTTGWSIFV  240
SQKNLVSGDA VLFLRGEGGD LRLGIRRAAR PRNGLPESII KTQYSGSDVL SAVATAVSVK  300
STFHVFYSPR ASHADFVVPY QKYMKSINSR IPVRTRFKMR FDLDDSPERR YSGVVTGIGD  360
MDPFRWPNSK WRCLMVRWDE DIMSNHQERV SPWEIDSSVS LPPMSIQSPR LKKLRTSQQA  420
PSLDSHFAGG NALLDFEELV RSSKVLQGQE NLGLISPPYG CDKTVRPLDI ELQNAARHNL  480
MPTGMENIIV GDFVKTQPPT TYTGFLESNR FPKVLQGQEI CSLRSLTGKG DVNFGAWEKP  540
EFGCNVFSTY QRPKTNFYPL ASEGARNVFL PYNAMYRAGQ DPVVHSYINN NFQRENPTLN  600
QNSIQNGVRR EEGGMQKFAN EQRPPEMSKL SIPETNFKNE NGSSLNAQAS CKLFGFSLIK  660
EPSTPSSHSS GKRSCTKVHK QGSLVGRAID LSRLNGYEDL LVELERLFNM EDLLRDPNKG  720
WRILYTDSEN DMMVVGDDPW HEFCEVVSKI HIYTQEEVEK MTIEGISDDT QSCLEEAPAF  780
MDASKSSSVG QPDSSPTAIR I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-110453962353Auxin response factor 1
4ldw_A1e-110453962353Auxin response factor 1
4ldw_B1e-110453962353Auxin response factor 1
4ldy_A1e-110453962353Auxin response factor 1
4ldy_B1e-110453962353Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779766.10.0PREDICTED: auxin response factor 4
RefseqXP_016462299.10.0PREDICTED: auxin response factor 4-like
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLM1AE600.0M1AE60_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000208390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4